DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and AT2G26370

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_180205.1 Gene:AT2G26370 / 817177 AraportID:AT2G26370 Length:173 Species:Arabidopsis thaliana


Alignment Length:120 Identity:25/120 - (20%)
Similarity:38/120 - (31%) Gaps:33/120 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ALAAGDVSISNCPKSKCILKRNTEASIQMKIR--PERDFQELTSDIQGIILDVPLPFPGYYGTSA 95
            |..||..:..||..:............:::|.  |...:.|.|..|.|...|     ..|....|
plant    21 AFGAGAYNFENCKNAPIDYNYGITNVTRVEISPYPVGPYDEPTITISGFTSD-----DSYIIYRA 80

  Fly    96 CPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVSLEIHWGLGDKHGDAAC 150
            ..|:                 :|.|:|      |..|:   |::.|.|..|:..|
plant    81 TIHV-----------------LYKYEN------VNSTI---INYDLSDVMGEDPC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 25/120 (21%)
AT2G26370NP_180205.1 PG-PI_TP 29..163 CDD:238459 22/112 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.