powered by:
Protein Alignment Npc2b and AT2G16005
DIOPT Version :9
Sequence 1: | NP_650331.1 |
Gene: | Npc2b / 41710 |
FlyBaseID: | FBgn0038198 |
Length: | 159 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_565385.1 |
Gene: | AT2G16005 / 816096 |
AraportID: | AT2G16005 |
Length: | 160 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 17/71 - (23%) |
Similarity: | 30/71 - (42%) |
Gaps: | 23/71 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKLSLGLFVIFAALIGFTSSTDVSQCPKS--------------KSKALAAG---DVSISNCPKSK 48
:||::|:|.:..... |..|::.||.: :.|..|.| .:||::.|..:
plant 76 LKLAVGMFPVSTKSY---SLCDITACPVAPGPIVLTLPNIFTPREKRTAIGYTIIISITDKPLKE 137
Fly 49 ---CIL 51
|||
plant 138 SMMCIL 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11306 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.