DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and Npc2

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_075898.1 Gene:Npc2 / 67963 MGIID:1915213 Length:149 Species:Mus musculus


Alignment Length:155 Identity:40/155 - (25%)
Similarity:69/155 - (44%) Gaps:13/155 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDF 69
            |...::..||:. .|..:........||.....:|::|.||...|.|.:....|:.:........
Mouse     4 LAATILLLALVA-ASQAEPLHFKDCGSKVGVIKEVNVSPCPTDPCQLHKGQSYSVNITFTSGTQS 67

  Fly    70 QELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKK-VGCPLKAGQVYTYKNSFKILPVYPTV 133
            |..|:.:.||:..:.:|||          |.:..|.|. :.||::..:||:|.|...:...||::
Mouse    68 QNSTALVHGILEGIRVPFP----------IPEPDGCKSGINCPIQKDKVYSYLNKLPVKNEYPSI 122

  Fly   134 SLEIHWGL-GDKHGDAACFQIPAKI 157
            .|.:.|.| .||..:..|::||.:|
Mouse   123 KLVVEWKLEDDKKNNLFCWEIPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 34/133 (26%)
Npc2NP_075898.1 Npc2_like 24..145 CDD:238458 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 1 1.010 - - QHG49115
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.830

Return to query results.
Submit another query.