DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and LOC5667676

DIOPT Version :10

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_001689314.2 Gene:LOC5667676 / 5667676 VectorBaseID:AGAMI1_002801 Length:152 Species:Anopheles gambiae


Alignment Length:89 Identity:30/89 - (33%)
Similarity:41/89 - (46%) Gaps:13/89 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKI-LP-VYPTVS 134
            ||:.:.|  |||....|... ..||     ..|.....||:.|||.:.|:.::.: || |..||.
Mosquito    72 LTARLLG--LDVGFDIPEEL-RDAC-----AVGISGASCPIAAGQSFDYELNYAMELPLVGITVQ 128

  Fly   135 LEIHWGLGDKHGDA-ACFQIPAKI 157
            :|:  ||....|.| .|.:|.|.|
Mosquito   129 VEV--GLTAADGSAVTCVEIDAAI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 28/85 (33%)
LOC5667676XP_001689314.2 None

Return to query results.
Submit another query.