DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and npc2

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_012823720.1 Gene:npc2 / 493351 XenbaseID:XB-GENE-6258064 Length:156 Species:Xenopus tropicalis


Alignment Length:160 Identity:41/160 - (25%)
Similarity:66/160 - (41%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLFVIFAALIGFTSST----DVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPE 66
            ||..:...:....||.    ....|.....|.:.   :.:|.||:..|.|.|.:..::.......
 Frog     9 GLLTVLLTVFLLPSSVPEPLKYKDCGSQSGKLVT---LDVSPCPEEPCPLVRGSTYTVNATFVSN 70

  Fly    67 RDFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKK-VGCPLKAGQVYTYKNSFKILPVY 130
            .:.:..::.:.|||..:.:|||          |.:..|.|. :.||:.:||.|||.....|...|
 Frog    71 VNSKSASAVVHGIIAGIAVPFP----------ISEPDGCKSGISCPINSGQTYTYVTKLPIKSEY 125

  Fly   131 PTVSLEIHWGLGDKHG-DAACFQIPAKIKA 159
            |.:.|.:.|.|.|::. |..|:.||..|.|
 Frog   126 PCIKLVVKWQLQDENNKDLFCWLIPVHIAA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 34/133 (26%)
npc2XP_012823720.1 Npc2_like 30..151 CDD:238458 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.