DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and Npc2f

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_651219.1 Gene:Npc2f / 42864 FlyBaseID:FBgn0039154 Length:170 Species:Drosophila melanogaster


Alignment Length:124 Identity:32/124 - (25%)
Similarity:52/124 - (41%) Gaps:18/124 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VSISNCPKSKCILKRNTEASIQMKIRPERDFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEA 103
            :.|.:|....|.:.||  |:|::.:|    |.:..:.:..:..:|...| .|..|.|.  |..:.
  Fly    58 LDIESCTTLPCSMARN--ATIKVTVR----FDDNGNGVSFLKHEVRWVF-NYIKTQAA--ITPDP 113

  Fly   104 GEKKVGC--PLKAGQVYTYKNSF--KILPVYPTVSLEIHWGLGDKHG-DAACFQIPAKI 157
            .:...||  ....|:.| :.|.|  :.|||.....|   |...|.:. :..|||:|..|
  Fly   114 CDGDHGCIESASGGKAY-WANIFVNETLPVMKGSML---WESKDANDQNLICFQVPVVI 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 30/120 (25%)
Npc2fNP_651219.1 Npc2_like 46..166 CDD:238458 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6567
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.