DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and Npc2c

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_649976.1 Gene:Npc2c / 41233 FlyBaseID:FBgn0037783 Length:165 Species:Drosophila melanogaster


Alignment Length:174 Identity:48/174 - (27%)
Similarity:72/174 - (41%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLSLGLFVIFAALIGFTSSTDVSQCPKSK-SKALAAGDVSISNCPKSKCILKRNTEASIQMKIRP 65
            ||||.| |:.........||.:.||..|. .:.|.   |.|.:|....|.|.:.|||.|.::...
  Fly     6 KLSLCL-VLSIMWTSVADSTPIRQCADSNYPQPLM---VQIDDCDALPCDLWKGTEAKIDIQFVA 66

  Fly    66 ERD-FQELTSDIQGIILDVPLPFPGYYGTSACPHIYD-EAGEKKV--------GCPLKAGQVYTY 120
            .|: .::|::::....|.|.:|             || ||....|        .|||.||:..||
  Fly    67 TRNTMKKLSAEVHLTSLGVTIP-------------YDLEASRGNVCSNLLHGAYCPLDAGEDVTY 118

  Fly   121 KNSFKILPV---YPTVSLEIHWGL---GDKHGDAACFQIPAKIK 158
            :   .:|||   .|.|...:...|   .|::...:||....::|
  Fly   119 Q---LLLPVTTNQPEVPTRLEVRLLDSDDENRVVSCFLADTRVK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 39/148 (26%)
Npc2cNP_649976.1 Npc2_like 26..155 CDD:238458 39/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.