DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and Npc2a

DIOPT Version :10

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_608637.1 Gene:Npc2a / 33374 FlyBaseID:FBgn0031381 Length:148 Species:Drosophila melanogaster


Alignment Length:87 Identity:19/87 - (21%)
Similarity:38/87 - (43%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VWDDAK----FRQELLDSDEERYSIGDAPYIMDDDDTLDDILRDTYHESASNPIEHYQTDETILS 180
            :||..:    |:::..::.::.|:....| ..|:..||......|..:.::......|.|.|..|
  Fly   162 IWDGEETVYCFKEKSRNALKDCYTRNRYP-TPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQS 225

  Fly   181 SDDENDYSTLDLR-QQANGSFR 201
            |..:...|.|.:. .|.:||::
  Fly   226 SRPDLMMSVLPVTPDQMDGSYQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 8/38 (21%)
Npc2aNP_608637.1 Npc2_like 21..145 CDD:238458
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.