DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and Npc2e

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_731439.2 Gene:Npc2e / 326136 FlyBaseID:FBgn0051410 Length:168 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:76/159 - (47%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMK-IRPERD 68
            |.:.|..|.::...::|:|.|| |:|...|   ||:|.:|.:..|::.:.|.|.:::. :....:
  Fly     2 LRIVVTLALILATVNATNVQQC-KNKPFPL---DVNIKDCEEPPCVVYKGTIAVMEVHFLGNNNN 62

  Fly    69 FQELTSDIQGIILDVPLPFPGYYGTSACP-HIYDEAGEKKVG--CPLKAGQVYTYKNSFKILPVY 130
            .:.:|:.....:|.:.||:       |.| .:.|.......|  ||:...:..||:.:|.:.|.:
  Fly    63 IKSITATTTAKVLGMNLPY-------ALPDEVSDVCRNLLYGAICPIDKDEDVTYQFNFYVEPSF 120

  Fly   131 PTVSLEIHWGLGDKHGD-AACFQIPAKIK 158
            |.::.::...|.|...: ..||.:..||:
  Fly   121 PEITADVTVTLNDAQNEPITCFVVSCKIR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 32/136 (24%)
Npc2eNP_731439.2 ML 20..144 CDD:294195 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.