DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and Npc2

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_775141.2 Gene:Npc2 / 286898 RGDID:628756 Length:152 Species:Rattus norvegicus


Alignment Length:154 Identity:42/154 - (27%)
Similarity:71/154 - (46%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIFAALIGFTSSTDV--SQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDFQE 71
            ::..||:..|.:..:  ..|   .||.....:|::|.||...|.|.:....|:.:........|.
  Rat    11 ILLLALVAATQAEPLHFKDC---GSKVGVIKEVNVSPCPTQPCQLHKGQSYSVNVTFTSGTQSQN 72

  Fly    72 LTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEK-KVGCPLKAGQVYTYKNSFKILPVYPTVSL 135
            .|:.:.||:..||:.||          |.:..|.| .:.||::..:||:|.|...:...||::.|
  Rat    73 STALVHGILAGVPVYFP----------IPEPDGCKCGINCPIQKDKVYSYLNKLPVKSEYPSLKL 127

  Fly   136 EIHWGL-GDKHGDAACFQIPAKIK 158
            .:.|.| .||..:..|::||.:||
  Rat   128 VVEWKLQDDKKDNLFCWEIPVEIK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 36/135 (27%)
Npc2NP_775141.2 Npc2_like 27..148 CDD:238458 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49115
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.