DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and npc2.1

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_775331.1 Gene:npc2.1 / 282673 ZFINID:ZDB-GENE-021206-13 Length:149 Species:Danio rerio


Alignment Length:154 Identity:33/154 - (21%)
Similarity:61/154 - (39%) Gaps:15/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFVIFAALIGFTSSTDVS--QCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPERDF 69
            |.|:..:.:.:|.:..|.  .|.....|.:   .|.|..|.:..|.|.:....::.:......:.
Zfish     6 LGVVLLSFLAYTCADPVKFVDCGSVDGKVV---QVDIKPCSQQPCKLHKGQSYTVNVTFSSGVES 67

  Fly    70 QELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPVYPTVS 134
            |...:.:.|::..||:|||       .|  .|:..:..:.||:...:.|.|.....:...||.:.
Zfish    68 QTSKAVVHGVLAGVPVPFP-------IP--IDDGCKSGIQCPIVPQKPYNYVTELPVKTEYPAIK 123

  Fly   135 LEIHWGL-GDKHGDAACFQIPAKI 157
            :.:.|.| .|...|..|.:.|.:|
Zfish   124 VVVEWELRDDSSKDLFCIKFPVQI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 28/134 (21%)
npc2.1NP_775331.1 Npc2_like 24..145 CDD:238458 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49115
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.