DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and heh-1

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001379800.1 Gene:heh-1 / 175426 WormBaseID:WBGene00006452 Length:154 Species:Caenorhabditis elegans


Alignment Length:161 Identity:37/161 - (22%)
Similarity:63/161 - (39%) Gaps:22/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCP------KSKCILKRNTEASIQMKIRPER 67
            |||.||:|..::..:....|..........|....|.      |..|:.|:.:...||:..:|.:
 Worm     4 VIFLALLGLAAAEFIEIGYKVCKSDGTVSQVKADGCELTVKDGKKVCLFKKGSRPIIQIAFKPSK 68

  Fly    68 DFQELTSDIQGIILDVPLPFPGYYGTSAC---PHIYDEAGEKKVGCPLKAGQVYTYKNSFKILPV 129
            |..:|.:.::..:           |.||.   |....:|....|.||:.||:...::.|..|...
 Worm    69 DTDKLKTSVRAKV-----------GGSAMVDFPQTNSDACTYGVKCPVSAGENQIFEQSISITEN 122

  Fly   130 YPTVS-LEIHWGL-GDKHGDAACFQIPAKIK 158
            :|... ::::|.| ....|...|....|:||
 Worm   123 HPAGEVIQVNWQLTRPDSGKEVCIIFLAEIK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 28/142 (20%)
heh-1NP_001379800.1 Npc2_like 22..150 CDD:238458 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I7325
eggNOG 1 0.900 - - E1_KOG4063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1612792at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.