DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and HCM1

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_009991.2 Gene:HCM1 / 850429 SGDID:S000000661 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:488 Identity:109/488 - (22%)
Similarity:168/488 - (34%) Gaps:160/488 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DSTKASNQQLAPGDSQQAIQ----NANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQI 121
            |:...||..|...:..|:::    |...|||..        .|||.||..||..:.:.:||||||
Yeast    79 DTCARSNGNLTLEEILQSLERRRINGELAKKPP--------YSYATLICLAILQSQEGKLTLSQI 135

  Fly   122 YEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMLNPEAKP------ 180
            |.|:..:.||:|.|     .|.|:|||||||||::.|::.:....||..:|.:.|.|:.      
Yeast   136 YHWIHVHFPYYKQK-----DASWQNSIRHNLSLNDAFIKTEKSCDGKGHFWEVRPGAETKFFKGE 195

  Fly   181 --------------GKSVRRRAASMETSRYEKRRGR-----AKKRVEALRQAGV-VGLNDATPSP 225
                          ||.....:...|..:.|...|.     .::|.||.:...: :.||.   ||
Yeast   196 NRGYEFVKDSLQDIGKYFEIDSTLDELEQVESGEGNDDLPDEEEREEAGKFPSIEIQLNS---SP 257

  Fly   226 SSSVSEGLDHFPESPLHSGGGFQLSP-----DFRQRASSNASSCGRLSP---------------- 269
            ...||: |.|.|:....:.   .|:|     ..|....::.::...|.|                
Yeast   258 ILRVSQ-LHHIPQLKTDNS---VLNPHENLESMRNMIENDVNNIDSLEPPYVMKKYHTSLGLPSL 318

  Fly   270 IRAQDLEPDWGFPVDYQNTTMTQAHAQALEELTGTMADE-----LTLCNQQQQGFS---AASGLP 326
            :.|:|     .|....:|..:|||:......:|...:.:     .|..|...:..|   :..|..
Yeast   319 VNAKD-----HFQAGVKNNNITQANRFNTLPITSAKSPQNFRKYFTSFNSNFEDLSPLRSNVGAG 378

  Fly   327 SQPPPPPYQP--------------PQHQQAQQQQQQQSPYALNG--------------------- 356
            |...|.||.|              ||.||:....|...|.:.:|                     
Yeast   379 SLLDPLPYSPLKLYDQKNLALMSKPQSQQSYSNSQLPPPPSSHGSDLLKTPKMRHSDGLEKTPSR 443

  Fly   357 ----PASGYNTLQP-QSQCLLHRSLNCSCMHNA---------------------RDGLSPNSVTT 395
                |..|.:.|:. |:...|...|.||.:..|                     |...:|:.:|:
Yeast   444 LISTPKDGNSILRKWQTPSHLFEDLYCSPLFRAIETPIRYITTPGGTLETQISPRKSSAPDVLTS 508

  Fly   396 TMSPAYPNS---------------EPSSDSLNT 413
            ..:..:.:|               |..||..||
Yeast   509 ATNSKFASSGLFGVDVYSVWKRATEKISDGNNT 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 34/79 (43%)
HCM1NP_009991.2 COG5025 20..564 CDD:227358 109/488 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.