DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and fd96Cb

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:298 Identity:74/298 - (24%)
Similarity:122/298 - (40%) Gaps:86/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQN 163
            ||..|...||..:..:.|.||:||.:::...|:::     .::..|:||:|||||.::.|::|..
  Fly    17 SYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYR-----KNTQKWQNSLRHNLSFNDCFIKVPR 76

  Fly   164 EGT--GKSSWWMLNPEA----KPGKSVRRRAASMETSRYEKRRGRAK---KRVEALRQAGVVGLN 219
            ..|  ||.|:|.|:|.|    :.|..:|||           :|.|.|   |.:...:.|      
  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRR-----------KRFRVKQLEKDISNWKLA------ 124

  Fly   220 DATPSPSSSVSEGLDHFPESPLHSGGGFQLS---PDFRQRASSNASSCGRLSPIRAQDLEPDWGF 281
                  :::.:|.:.|:.:..|     .|::   |.......:|||: .::||.:|..       
  Fly   125 ------AAANTEMVTHYLDDQL-----TQMAFADPARHGHVLANASA-AQMSPYKATP------- 170

  Fly   282 PVDYQNTTMTQAHAQALEELT--GTMA-DELTLCNQ----QQQGFSAASGLPSQPPPPPYQPP-- 337
            |:  ..||:||..|:.....|  ..|| |..:..|:    .:.|...|..|..    ||:..|  
  Fly   171 PI--LPTTVTQLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEK----PPFNLPFN 229

  Fly   338 QHQQAQQQQ------------------QQQSPYALNGP 357
            .::.|.|.|                  |:..|...|||
  Fly   230 FNELAAQYQLYFPSFFYNGQYGNIPCYQKTPPLFHNGP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 26/77 (34%)
fd96CbNP_524496.1 FH 13..101 CDD:214627 29/88 (33%)
Alpha_kinase 106..>194 CDD:295997 24/125 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.