DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and FoxP

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster


Alignment Length:196 Identity:60/196 - (30%)
Similarity:83/196 - (42%) Gaps:53/196 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDS 138
            |.||.|.......||:..|..:   :||.||..||..:.||:|||::||.|......||:     
  Fly   310 DVQQEIHRNREFYKNADVRPPF---TYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFR----- 366

  Fly   139 NSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMLNPEAKPGKSVRRRAASMETSRYEKRRGRA 203
            .::|.|||:||.|||||..|:|.:::   ..|:||::    ..:.|:||..|         |||.
  Fly   367 RNAATWKNAIRTNLSLHKCFVRYEDD---FGSFWMVD----DNEFVKRRHLS---------RGRP 415

  Fly   204 KKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGGFQLSPDFRQRASSNASSCGRLS 268
            :|.                 .||||        |.| ..||.|.   |..:....:....|..|.
  Fly   416 RKY-----------------EPSSS--------PNS-CQSGNGV---PTDKNPCDNCTQHCTSLP 451

  Fly   269 P 269
            |
  Fly   452 P 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 32/79 (41%)
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 33/82 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.