DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and croc

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster


Alignment Length:468 Identity:113/468 - (24%)
Similarity:177/468 - (37%) Gaps:156/468 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SNQQLAPGDSQQAIQNANAAKKNSSR----RNAWG-------------NLSYADLITHAIGSATD 113
            |...:|...|..|...|:.|....||    .:|:|             ..||..||..||.:|.|
  Fly    24 SASAVAAASSASAAAAAHYAYDQYSRYPYSASAYGLGAPHQNKEIVKPPYSYIALIAMAIQNAAD 88

  Fly   114 KRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRV--QNEGTGKSSWWMLNP 176
            |::||:.||:::::..||::|     :..||:|||||||||:..|::|  .::..||.|:|.|:|
  Fly    89 KKVTLNGIYQYIMERFPYYRD-----NKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDP 148

  Fly   177 EA----KPGKSVRRRAASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGL---- 233
            ::    ..|..:|||       |..|::...:::.||:::..::....|...|...::.|:    
  Fly   149 DSYNMFDNGSFLRRR-------RRFKKKDVMREKEEAIKRQAMMNEKLAEMKPLKLMTNGILEAK 206

  Fly   234 ------DHFPESPLHSGG---GFQLSPDFRQRASSNA--SSCGRLSPIRAQDLEPDWGFPVD--- 284
                  .||.:.||...|   |.::|    ..|..|:  .|..:::.:....:|.. ||.||   
  Fly   207 HMAAHAAHFKKEPLMDLGCLSGKEVS----HAAMLNSCHDSLAQMNHLAGGGVEHP-GFTVDSLM 266

  Fly   285 ----------------YQNTTMTQA--------------HAQALEELTGTMADELTLCNQQQQGF 319
                            .::...|.|              |||.|:.....:|..||      .|.
  Fly   267 NVYNPRIHHSAYPYHLNEDNLATVASSQMHHVHHAAAAHHAQQLQRHVAHVAHPLT------PGG 325

  Fly   320 SAASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNGPASG--YNTLQPQSQCLLHRSLNCSCMH 382
            ..|.|..|...|.....|                 :|||.|  |....|.|:         ...|
  Fly   326 QGAGGQSSGHSPTTISTP-----------------HGPAHGGWYTPETPPSE---------PVPH 364

  Fly   383 NARDGLSPNSVTTTMSPAYP--NSEPSSDSLN----------------TYSNVVLDGPADTAAL- 428
            |.:.|          :|.:|  |:..||..||                ..|:|:...|  |:|| 
  Fly   365 NGQQG----------TPTHPGHNNNNSSSVLNHNGVGNGGGGGGGGGGGSSSVLTSSP--TSALG 417

  Fly   429 ---MVQQQQQQQQ 438
               |:.:|.|..|
  Fly   418 FRDMIFEQNQSCQ 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 34/94 (36%)
crocNP_524202.1 Forkhead 70..156 CDD:278670 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445550
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.