DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and FoxK

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:483 Identity:118/483 - (24%)
Similarity:178/483 - (36%) Gaps:168/483 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GLAMDQLGGD-----LPLDVGFEPQ-----------TRARSNTWPCPRPENFVEPTDELDSTKAS 66
            |.|...:.||     .||.:....:           |.:.:|:.|....:.|::......:...:
  Fly   369 GAAAHLIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGN 433

  Fly    67 NQQLAPGDSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPY 131
            |      ::|...|..:.|..|.:.:..:   |||.||..||.:|.||:||||.||.::|::.||
  Fly   434 N------NTQDLFQTPSTASYNHNEKPPY---SYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPY 489

  Fly   132 FKDKGDSNSSAGWKNSIRHNLSLHNRFMRV---QNEGTGKSSWWMLNPEAKPGKSVRRRAASMET 193
            ::    ..::.||:|||||||||:..|::|   |:| .||.|:|.::|::         .|.:..
  Fly   490 YR----KETNKGWQNSIRHNLSLNRYFIKVARSQDE-PGKGSFWRIDPDS---------GAKLID 540

  Fly   194 SRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGGFQLSPDFRQRAS 258
            ..|:|||.|:.:           |.......|.|:        |.||.|.....:.||       
  Fly   541 HSYKKRRQRSSQ-----------GFRPPYGMPRSA--------PVSPSHMDNSRESSP------- 579

  Fly   259 SNASSCGRLSPIRAQD--LEPDWGFPVDYQNTTMTQAHAQALEELTGTMADELTLCNQQQQGFSA 321
                         .||  |:...|.|            ..:||:   ..||...:.|.|.     
  Fly   580 -------------LQDIVLQSAPGSP------------GMSLEQ---RAADPEIIYNSQN----- 611

  Fly   322 ASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNGPASGYNTLQPQSQCLLHRSLNCSCMHNARD 386
                            .|||.|||||||....|:..::.|::                       
  Fly   612 ----------------AHQQQQQQQQQQQQQTLSNNSNQYSS----------------------- 637

  Fly   387 GLSPNSVTTTMS-PAYPNS--EPSSDS-----------LNTYSNVVLDGPADTAALMVQQQQQQQ 437
            | ||..||...| .|.|.:  |.|:.|           |....|.|:.|.|....|..||...||
  Fly   638 G-SPYYVTNQSSGVATPQTHVEGSAASGGGGGGGVGALLALKRNHVMGGGASQHTLHQQQAVAQQ 701

  Fly   438 QQQQL---------SASLE--DNNCAST 454
            |..::         |..:|  :..|.:|
  Fly   702 QHSEIIYEELPTDYSGHIEASEEECVTT 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 38/82 (46%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 40/103 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445552
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.