DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and fd59A

DIOPT Version :10

Sequence 1:NP_650330.3 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster


Alignment Length:106 Identity:43/106 - (40%)
Similarity:62/106 - (58%) Gaps:17/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQN 163
            ||..|||.||..:..|:||||.|.::::...||:|||     ...|:|||||||||::.|::|..
  Fly    89 SYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDK-----FPAWQNSIRHNLSLNDCFIKVPR 148

  Fly   164 E--GTGKSSWWMLNPEAKP----GKSVRRRAASMETSRYEK 198
            |  ..||.::|.|:|.|:.    |..:|||      .||::
  Fly   149 EPGNPGKGNFWTLDPLAEDMFDNGSFLRRR------KRYKR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_650330.3 FH_FOXO 96..175 CDD:410806 34/77 (44%)
fd59ANP_523814.1 FH_FOXD4-like 85..180 CDD:410822 41/101 (41%)

Return to query results.
Submit another query.