DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and slp2

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster


Alignment Length:414 Identity:103/414 - (24%)
Similarity:154/414 - (37%) Gaps:119/414 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HTDNGLAMDQLGG----------DLPLDV-GFEPQTRARSN-TWPCPRPENFVEPTDELDSTKAS 66
            |.:|.|.....|.          :..||| ...|...|..| :.|....|.|||...|.|.    
  Fly    95 HNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDG---- 155

  Fly    67 NQQLAPGDSQQAIQNANAAKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPY 131
              :...||::....:....|  ..:.|.....||..||..||..:::|||||:.|||:::.|.||
  Fly   156 --ETTDGDAENKSNDGKPVK--DKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPY 216

  Fly   132 FKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQN--EGTGKSSWWMLNPEAK-------PGKSVRRR 187
            ::|     :..||:|||||||||:..|::|..  :..||.::|||:|.|:       .||..||.
  Fly   217 YRD-----NKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRT 276

  Fly   188 AASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGGFQLSPD 252
            .|:            ::.|:.|.::: ::|          .:..||..:|:.     |.|...|.
  Fly   277 TAA------------SRSRLAAFKRS-LIG----------PMFPGLAAYPQF-----GQFLTYPP 313

  Fly   253 FRQRASSNASSCGRLSPIRAQDLEPDWGFPVDYQNTTMTQAHAQALEELTGTMADELTLCNQQQQ 317
              ...|..||...|.:|...:......|.|             ..|..|.|....:         
  Fly   314 --TAPSLLASMYQRYNPFAPKGGPGHPGLP-------------PGLPGLPGPPGPQ--------- 354

  Fly   318 GFSAASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNGPASGYNTLQPQSQCLLHRSLNCSCMH 382
                  |.|..||||...||...:..|:.|.|.                    |||:       |
  Fly   355 ------GPPGPPPPPFVAPPTSSELYQRLQYQQ--------------------LLHQ-------H 386

  Fly   383 NARDGLSPNSVTTTMSPAYPNSEP 406
            .|...|:.:....:::.|...|:|
  Fly   387 AAAAALAAHQRQLSVAAASAASQP 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 35/81 (43%)
slp2NP_476834.1 Forkhead 180..265 CDD:306709 38/89 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445531
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.