DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and fd19B

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:310 Identity:69/310 - (22%)
Similarity:115/310 - (37%) Gaps:89/310 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LDSTKASNQQLAPGDSQQAIQNANAAKKNSS------RRNAWGNLSYADLITHAIGSATDKRLTL 118
            |...|.....::..:|..:..:.:::..|||      :.||....:|:.||..||.|:::|||||
  Fly    17 LSVDKKEESPISKHNSGSSFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTL 81

  Fly   119 SQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQN--EGTGKSSWWMLNPEAKPG 181
            |.|.:|:..|.||::.:     .:.|:|||||||||:..|:||..  :..|:..:|.|:|.|: .
  Fly    82 SGICKWIADNFPYYRTR-----KSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDPYAE-D 140

  Fly   182 KSVRRRAASMETSRYEKRRGRAKKRVEALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHSGGG 246
            .|:......:..|.:::..|                   |.|..:....:.:.::...  |..|.
  Fly   141 LSIGETTGRLRRSNWQQNTG-------------------ARPKVTGHPYQRMPYYGHG--HGNGP 184

  Fly   247 FQLSPDFRQRASSNASSCGRLSPIRAQDLEPDWGFPV-DYQNTTMTQAHAQALEELTGTMADELT 310
            :                      |:|....    ||: |:|:......|.||:......|     
  Fly   185 Y----------------------IKAHSAY----FPIMDHQHHAAMVQHYQAMMHRYQMM----- 218

  Fly   311 LCNQQQQGFSAASGLPSQPPPPPYQPPQHQQAQQQQ---QQQSPYALNGP 357
                               |.|.:...|||......   ||..|..:..|
  Fly   219 -------------------PHPHHHQHQHQHQHPHSHFIQQSKPLHIQEP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 32/81 (40%)
fd19BNP_608369.1 FH 58..135 CDD:238016 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445532
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.