DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment foxo and FOXO3B

DIOPT Version :9

Sequence 1:	NP_001262557.1	Gene:	foxo / 41709	FlyBaseID:	FBgn0038197	Length:	622	Species:	Drosophila melanogaster
Sequence 2:	NP_001355063.1	Gene:	FOXO3B / 2310	HGNCID:	3822	Length:	290	Species:	Homo sapiens

Alignment Length:	191	Identity:	74/191 - (38%)
Similarity:	82/191 - (42%)	Gaps:	74/191 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    27 DLPLDVGFEPQTRARSNTWPCPRPENFVEPTDELDSTKA-------------------------- 65
            ::.||..||||:|.||.|||..|||....|......|.|
Human   100 EVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAI 164

  Fly    66 -----------------SNQQLAPGDSQQAIQNANAA---------------------------- 85
                             |.:.||||........|.||
Human   165 GGGGGSRTLVSGLLLEDSVRVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGS 229

  Fly    86 ---KKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAG 143
               :|.|||||||||||||||||.||.|:.|:||||||||||||..||||||||:||||||
Human   230 GQPRKCSSRRNAWGNLSYADLITRAIESSPDRRLTLSQIYEWMVSCVPYFKDKGNSNSSAG 290

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
foxo	NP_001262557.1	FH	95..175	CDD:238016	41/49 (84%)
FOXO3B	NP_001355063.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	44..239		29/138 (21%)
		FH	242..>282	CDD:381782	32/39 (82%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	47	1.000	Domainoid score	I12001
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	1	0.900	-	-		OOG6_108778
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.900