DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and pes-1

DIOPT Version :10

Sequence 1:NP_650330.3 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:131 Identity:41/131 - (31%)
Similarity:74/131 - (56%) Gaps:20/131 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ELDSTKASNQQLAPGDS----------QQAIQNA--NAAKKNSSRRNAWGNLSYADLITHAIGSA 111
            :|||:.:|:..::|..|          ||:.:|:  :::.::.::|..:   ||..||..||.|:
 Worm    48 DLDSSTSSSCSVSPASSFHTRSESVGQQQSGRNSPVSSSTESPTKRPKY---SYNALIAMAIQSS 109

  Fly   112 TDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQNEGTGKSSWWMLNP 176
            ..|.|.:|:||:::..|..|:|::    ....|:||:|||||||..|.:|:.. .||.|:|.:..
 Worm   110 PFKSLRVSEIYKYISSNFSYYKNQ----KPLQWQNSVRHNLSLHKEFRKVRTL-DGKGSYWAMTA 169

  Fly   177 E 177
            :
 Worm   170 D 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_650330.3 FH_FOXO 96..175 CDD:410806 31/78 (40%)
pes-1NP_001023406.1 Forkhead 93..168 CDD:459732 32/82 (39%)
rad23 <203..>240 CDD:273167
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.