DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and let-381

DIOPT Version :9

Sequence 1:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_491826.1 Gene:let-381 / 172331 WormBaseID:WBGene00002601 Length:362 Species:Caenorhabditis elegans


Alignment Length:340 Identity:82/340 - (24%)
Similarity:142/340 - (41%) Gaps:70/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GDLPLDVGFEPQTRARSNTWPCPRPENFVEPTDELDSTKASNQQLAPGDSQQAIQNANAAKKNSS 90
            |.|.||      :.|.:|:....:.||:.. .||.|..:.|::     ||:.:.::::.....|.
 Worm    15 GPLKLD------STAPNNSHRTIKAENYFN-EDEEDYNENSHE-----DSEDSKEDSDGQGCRSR 67

  Fly    91 RRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLH 155
            :|......||..||..||....||:.||::||.::.:|..:|:     ...|||:|||||||||:
 Worm    68 KRKEKPPFSYIALIAMAISKRPDKKATLAEIYSYLQENFEFFR-----GEYAGWRNSIRHNLSLN 127

  Fly   156 NRFMRVQNEGTG------KSSWWMLNPEAKPGKSVRRRAASMETSRYEKR-RG-RAKKR-----V 207
            ..|:::..: ||      |...|.::...:         ..:|.:.:.:| || :|:||     |
 Worm   128 ECFVKLPKD-TGESYRGRKGHKWTISDSCE---------FMLEENGFRRRPRGYKARKRTHFPGV 182

  Fly   208 EALRQAGVVGLNDATPSPSSSVSEGLDHFPESPLHS-------GGGFQLSPDFRQRASSNASSCG 265
            .|..:.|:.|.....||.::.:::.    ..|.|::       .||....|....:..|:.:| .
 Worm   183 TASNEMGIGGATFDYPSSTTELTDS----GTSSLNTDVKNILLNGGEDFGPSISDQLVSSTTS-A 242

  Fly   266 RLSPIRAQDLEP------DWG---FPVDYQNTTMTQAHAQALEELTGTMADELTLCNQQQQGFSA 321
            .|..:...|..|      .:|   ||:.:.:.|....:         .....:.||:....|.|.
 Worm   243 VLPSLNGPDQSPIYPNYFGYGTAEFPMQWASPTYDWPY---------YATPHIGLCSSDFPGISP 298

  Fly   322 ASGLPSQPPPPPYQP 336
            :..:..|..|..|.|
 Worm   299 SPTVTPQVSPYFYPP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_001262557.1 FH 95..175 CDD:238016 31/85 (36%)
let-381NP_491826.1 Forkhead 71..160 CDD:365978 31/103 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I3932
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.