DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment foxo and Foxa3

DIOPT Version :10

Sequence 1:NP_650330.3 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_032286.1 Gene:Foxa3 / 15377 MGIID:1347477 Length:353 Species:Mus musculus


Alignment Length:185 Identity:57/185 - (30%)
Similarity:85/185 - (45%) Gaps:28/185 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNSIRHNLSLHNRFMRVQN 163
            ||..|||.||..|..|.||||:||:|::...||:::     :...|:|||||:||.::.|::|..
Mouse   123 SYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRE-----NQQRWQNSIRHSLSFNDCFVKVAR 182

  Fly   164 --EGTGKSSWWMLNPEA----KPGKSVRR--------RAASMETSRYEKRRGRAKKRVEALRQAG 214
              :..||.|:|.|:|.:    :.|..:||        :|....::....|.|.|.....|...|.
Mouse   183 SPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKAKKGNSATSASRNGTAGSATSATTTAA 247

  Fly   215 VVGLNDATPSPSSSVSE--------GLD-HFPESPLHSGGGFQLSPDFRQRASSN 260
            ....:.|.|.|:.|..|        ||| ..|.|......|.:|..:.:..|..|
Mouse   248 TAVTSPAQPQPTPSEPEAQSGDDVGGLDCASPPSSTPYFSGLELPGELKLDAPYN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
foxoNP_650330.3 FH_FOXO 96..175 CDD:410806 32/77 (42%)
Foxa3NP_032286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..83
FH_FOXA3 117..218 CDD:410814 37/99 (37%)
COG5025 <118..323 CDD:227358 57/185 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..287 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.