DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9922 and AT3G06610

DIOPT Version :9

Sequence 1:NP_001262556.1 Gene:CG9922 / 41708 FlyBaseID:FBgn0038196 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_566288.1 Gene:AT3G06610 / 819840 AraportID:AT3G06610 Length:115 Species:Arabidopsis thaliana


Alignment Length:121 Identity:37/121 - (30%)
Similarity:62/121 - (51%) Gaps:11/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EAAEINGREEVEDDEQDKKQKKSDVKRHDDGAADLERVTDYAEEKEISADNISSAVEQFGNQRNK 67
            |.||..|.|...|.:..::|.|:           .:::||..|::::.:..:.||:......|..
plant     2 EGAEEAGAEIAVDSKDLQQQSKA-----------FDKLTDRVEDRQLDSSRVQSAMASIAASREA 55

  Fly    68 ENELRVAKEKELQKVQVKKEDIELIMNELLVSKAHAEKVLREQSGDVVAALEAIIS 123
            :...:..:||||..|::...|:|.|:|||.:.|..||:.|||..||.|||...::|
plant    56 DLNAKRLREKELASVKINPADVEFIVNELEIEKNVAERTLREHKGDAVAATRQLLS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9922NP_001262556.1 metallo-dependent_hydrolases 15..>108 CDD:294200 23/92 (25%)
UBA_HYPK 82..122 CDD:270544 18/39 (46%)
AT3G06610NP_566288.1 UBA_HYPK 70..110 CDD:270544 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3610
eggNOG 1 0.900 - - E1_KOG3450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2504
OMA 1 1.010 - - QHG58337
OrthoDB 1 1.010 - - D1512609at2759
OrthoFinder 1 1.000 - - FOG0006550
OrthoInspector 1 1.000 - - oto3288
orthoMCL 1 0.900 - - OOG6_105012
Panther 1 1.100 - - LDO PTHR31184
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.