DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9922 and Hypk

DIOPT Version :9

Sequence 1:NP_001262556.1 Gene:CG9922 / 41708 FlyBaseID:FBgn0038196 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_080594.2 Gene:Hypk / 67693 MGIID:1914943 Length:129 Species:Mus musculus


Alignment Length:110 Identity:54/110 - (49%)
Similarity:79/110 - (71%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EVEDDEQDKKQKKSDVKRHDDGAADLERVTDYAEEKEISADNISSAVEQFGNQRNKENELRVAKE 76
            |:|.:....::.....::||.|||||||||||||||||.:.|:.:|:...|::|::|.:.:..:|
Mouse    18 ELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDRRSREQKAKQERE 82

  Fly    77 KELQKVQVKKEDIELIMNELLVSKAHAEKVLREQSGDVVAALEAI 121
            |||.||.:||||:||||.|:.:|:|.||:.|||..|:||.||.|:
Mouse    83 KELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIAL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9922NP_001262556.1 metallo-dependent_hydrolases 15..>108 CDD:294200 43/92 (47%)
UBA_HYPK 82..122 CDD:270544 23/40 (58%)
HypkNP_080594.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 6/23 (26%)
Required for association with the NAA10-NAA15 complex. /evidence=ECO:0000250|UniProtKB:Q9NX55 60..129 32/68 (47%)
UBA_HYPK 88..128 CDD:270544 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835458
Domainoid 1 1.000 110 1.000 Domainoid score I6297
eggNOG 1 0.900 - - E1_KOG3450
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9498
Inparanoid 1 1.050 111 1.000 Inparanoid score I4862
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58337
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006550
OrthoInspector 1 1.000 - - oto92046
orthoMCL 1 0.900 - - OOG6_105012
Panther 1 1.100 - - LDO PTHR31184
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3139
SonicParanoid 1 1.000 - - X6296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.