DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9922 and F13G3.10

DIOPT Version :9

Sequence 1:NP_001262556.1 Gene:CG9922 / 41708 FlyBaseID:FBgn0038196 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001379130.1 Gene:F13G3.10 / 3565846 WormBaseID:WBGene00008768 Length:96 Species:Caenorhabditis elegans


Alignment Length:105 Identity:36/105 - (34%)
Similarity:57/105 - (54%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EQDKKQKKSDVKRHDDGAADLERVTDYAEEKEISADNISSAVEQFGNQRNKENELRVAKEKELQK 81
            |:|:||:   |.:|:.|:.:|.:|:|..|||    |::....:..||..|.....|       .|
 Worm     3 EEDEKQQ---VDKHNWGSEELSKVSDTREEK----DDLKLNTDALGNLFNASAPAR-------PK 53

  Fly    82 VQVKKEDIELIMNELLVSKAHAEKVLREQSGDVVAALEAI 121
            :.:||||::||||||.:.:......|.|.:|||..||.::
 Worm    54 INIKKEDLQLIMNELELQEGTVRAKLIETNGDVREALRSL 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9922NP_001262556.1 metallo-dependent_hydrolases 15..>108 CDD:294200 29/90 (32%)
UBA_HYPK 82..122 CDD:270544 17/40 (43%)
F13G3.10NP_001379130.1 CCDC158 <6..>95 CDD:318193 34/102 (33%)
UBA_HYPK 54..94 CDD:270544 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158554
Domainoid 1 1.000 54 1.000 Domainoid score I7496
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I4064
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006550
OrthoInspector 1 1.000 - - oto19771
orthoMCL 1 0.900 - - OOG6_105012
Panther 1 1.100 - - LDO PTHR31184
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3139
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.