DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9922 and hypk

DIOPT Version :9

Sequence 1:NP_001262556.1 Gene:CG9922 / 41708 FlyBaseID:FBgn0038196 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001120942.1 Gene:hypk / 100151755 ZFINID:ZDB-GENE-080515-6 Length:121 Species:Danio rerio


Alignment Length:118 Identity:57/118 - (48%)
Similarity:84/118 - (71%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAEINGREEVEDDEQDKKQKKSDVKRHDDGAADLERVTDYAEEKEISADNISSAVEQFGNQRNKE 68
            |||.:...::|.:|....:.....::||.||||||:|||||||||||:.|:.:|:...|::|::|
Zfish     2 AAEGDVDLDLEAEENCTGKPTEKPRKHDSGAADLEKVTDYAEEKEISSSNLETAMSVIGDRRSRE 66

  Fly    69 NELRVAKEKELQKVQVKKEDIELIMNELLVSKAHAEKVLREQSGDVVAALEAI 121
            .:.:..:||||.||.:||||:||||.|:.:|:|.||:.|||..|:||.||.|:
Zfish    67 QKAKQEREKELAKVTIKKEDVELIMGEMEISRAVAERSLREHMGNVVEALIAL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9922NP_001262556.1 metallo-dependent_hydrolases 15..>108 CDD:294200 44/92 (48%)
UBA_HYPK 82..122 CDD:270544 23/40 (58%)
hypkNP_001120942.1 UBA_HYPK 80..120 CDD:270544 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578655
Domainoid 1 1.000 110 1.000 Domainoid score I6241
eggNOG 1 0.900 - - E1_KOG3450
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9498
Inparanoid 1 1.050 111 1.000 Inparanoid score I4861
OMA 1 1.010 - - QHG58337
OrthoDB 1 1.010 - - D1512609at2759
OrthoFinder 1 1.000 - - FOG0006550
OrthoInspector 1 1.000 - - oto40666
orthoMCL 1 0.900 - - OOG6_105012
Panther 1 1.100 - - LDO PTHR31184
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3139
SonicParanoid 1 1.000 - - X6296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.