DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9922 and hypk

DIOPT Version :9

Sequence 1:NP_001262556.1 Gene:CG9922 / 41708 FlyBaseID:FBgn0038196 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001120475.1 Gene:hypk / 100145587 XenbaseID:XB-GENE-999052 Length:121 Species:Xenopus tropicalis


Alignment Length:118 Identity:57/118 - (48%)
Similarity:83/118 - (70%) Gaps:0/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAEINGREEVEDDEQDKKQKKSDVKRHDDGAADLERVTDYAEEKEISADNISSAVEQFGNQRNKE 68
            |||.:...|:|.:|...::.....::||.|||||||||||||||||.:.|:.:|:...|::|::|
 Frog     2 AAEGDVELELETEENCSERPADKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDRRSRE 66

  Fly    69 NELRVAKEKELQKVQVKKEDIELIMNELLVSKAHAEKVLREQSGDVVAALEAI 121
            .:.:..:||||.||.:||||:||||||:.:.:..||:.|||..|:||.||.|:
 Frog    67 QKAKQEREKELAKVTIKKEDVELIMNEMEIPRTAAERSLREHMGNVVEALIAL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9922NP_001262556.1 metallo-dependent_hydrolases 15..>108 CDD:294200 43/92 (47%)
UBA_HYPK 82..122 CDD:270544 22/40 (55%)
hypkNP_001120475.1 UBA_HYPK 80..120 CDD:270544 22/40 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6156
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9498
Inparanoid 1 1.050 112 1.000 Inparanoid score I4726
OMA 1 1.010 - - QHG58337
OrthoDB 1 1.010 - - D1512609at2759
OrthoFinder 1 1.000 - - FOG0006550
OrthoInspector 1 1.000 - - oto102353
Panther 1 1.100 - - LDO PTHR31184
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.