DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and HLJ1

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:232 Identity:77/232 - (33%)
Similarity:109/232 - (46%) Gaps:62/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YTKDQ----LEAVRKVKTCKDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKAL 150
            :|:||    ||.:.|.|  .::||:|.|.:.||||||||||:|||::||||||..|.|.||||.:
Yeast     3 FTEDQEKIALEILSKDK--HEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVI 65

  Fly   151 GNAAGVLTDAEKRKNYDLYGIN----------ESHNGHGNNGGGHHGHG---QYYNNEYGYSRGF 202
            ..|..||::.|||..||..|.:          .:....|:.||...|.|   .::|:.:|..|..
Yeast    66 NRAFEVLSNEEKRSIYDRIGRDPDDRQMPSRGAASGFRGSAGGSPMGGGFEDMFFNSRFGGQRAG 130

  Fly   203 QADISAEELFNMFFN---------------------------------GGFPQQNVHMRQQ-RRR 233
                ..|::|:..||                                 ||.|    .|||| |.|
Yeast   131 ----PPEDIFDFLFNAGGSPFGASPFGPSASTFSFGGPGGFRVYTNNRGGSP----FMRQQPRSR 187

  Fly   234 QQAREDREGNNSSALVNLLPI-VLLIGLSMMSSFFIS 269
            ||.::..|...:|.|.|:|.: ::.|.|.|:..:..|
Yeast   188 QQQQQAEENAVNSQLKNMLVLFIIFIVLPMIKDYLFS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 53/164 (32%)
DnaJ 106..167 CDD:278647 35/60 (58%)
DUF1977 269..366 CDD:286411 1/1 (100%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 50/135 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I1517
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55696
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101281
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2148
SonicParanoid 1 1.000 - - X535
TreeFam 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.