DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and JEM1

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_012462.3 Gene:JEM1 / 853372 SGDID:S000003609 Length:645 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:43/128 - (33%)
Similarity:57/128 - (44%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SAPDYTKDQLEAVRKVKTCKDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKA------PGAV 144
            :||:|...           ||||::||||.:|:..||:|||..|..:.||||.||      ....
Yeast   529 AAPNYDPK-----------KDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIH 582

  Fly   145 EAFKALGNAAGVLTDAEKRKNYDLYGINESHN-----GHGNNGGGHHGHGQYYNNEYGYSRGF 202
            |....:..|...|:|.:|||.|||...|...|     ...||...:.|.|..:.|  |:...|
Yeast   583 ETMSQINEAYETLSDDDKRKEYDLSRSNPRRNTFPQGPRQNNMFKNPGSGFPFGN--GFKMNF 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 40/109 (37%)
DnaJ 106..167 CDD:278647 27/66 (41%)
DUF1977 269..366 CDD:286411
JEM1NP_012462.3 DnaJ 536..>644 CDD:223560 40/121 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.