DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnaja2

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 / 84026 RGDID:71001 Length:412 Species:Rattus norvegicus


Alignment Length:129 Identity:45/129 - (34%)
Similarity:62/129 - (48%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGIN 172
            |::|||...|:::|:||||:|||.:.|||||  |.|.:.||.:..|..||::.|||:.||.||..
  Rat    10 YDILGVPPGASENELKKAYRKLAKEYHPDKN--PNAGDKFKEISFAYEVLSNPEKRELYDRYGEQ 72

  Fly   173 ESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNG---GFPQQNVHMRQQRRR 233
            ....|.|..||                        .:::|:..|.|   ||.......|..|||
  Rat    73 GLREGSGGGGG------------------------MDDIFSHIFGGGLFGFMGNQSRSRNGRRR 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 41/118 (35%)
DnaJ 106..167 CDD:278647 28/58 (48%)
DUF1977 269..366 CDD:286411
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 45/129 (35%)
CXXCXGXG motif 143..150
CXXCXGXG motif 159..166
CXXCXGXG motif 186..193
CXXCXGXG motif 202..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.