DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnaja3

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_076135.3 Gene:Dnaja3 / 83945 MGIID:1933786 Length:480 Species:Mus musculus


Alignment Length:157 Identity:56/157 - (35%)
Similarity:73/157 - (46%) Gaps:26/157 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNK-APGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            |||::|||.:.|:..:|||||.:||.:.|||.|| .|.|.|.|..|..|..||:|..|||.||.|
Mouse    93 DYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAY 157

  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFN-------GGFPQQNVHM 227
            |......|..::|             .||.|| ...:..||||...|.       |.|  |||..
Mouse   158 GSAGFDPGTSSSG-------------QGYWRG-GPSVDPEELFRKIFGEFSSSPFGDF--QNVFD 206

  Fly   228 RQQRRRQQA--REDREGNNSSALVNLL 252
            :.|....:.  .:..:|.|....||::
Mouse   207 QPQEYIMELTFNQAAKGVNKEFTVNIM 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 48/125 (38%)
DnaJ 106..167 CDD:278647 31/61 (51%)
DUF1977 269..366 CDD:286411
Dnaja3NP_076135.3 DnaJ 90..480 CDD:223560 56/157 (36%)
DnaJ 93..155 CDD:278647 31/61 (51%)
DnaJ_C 207..416 CDD:199909 5/27 (19%)
DnaJ_zf 236..296 CDD:199908
CXXCXGXG motif 236..243
CXXCXGXG motif 253..260
CXXCXGXG motif 275..282
CXXCXGXG motif 289..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..468
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.