DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and ATERDJ3B

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_191819.1 Gene:ATERDJ3B / 825434 AraportID:AT3G62600 Length:346 Species:Arabidopsis thaliana


Alignment Length:121 Identity:45/121 - (37%)
Similarity:64/121 - (52%) Gaps:27/121 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKA-PGAVEAFKALGNAAGVLTDAEKRKNYDL 168
            |.||:||.|.|.|:|.:||:||:||||:.|||||:. ..|...|..:.||..||:|.|||:.|:.
plant    25 KSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSDEEKREIYNK 89

  Fly   169 YGIN-----ESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGG 219
            ||..     .::.|.|..|||                     ::.:::|:.||.||
plant    90 YGEEGLKQFSANGGRGGGGGG---------------------MNMQDIFSSFFGGG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 44/120 (37%)
DUF1977 264..364 CDD:462754
ATERDJ3BNP_191819.1 DnaJ_bact 26..343 CDD:274090 44/120 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.