DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and AT2G41000

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001118491.1 Gene:AT2G41000 / 818700 AraportID:AT2G41000 Length:211 Species:Arabidopsis thaliana


Alignment Length:130 Identity:46/130 - (35%)
Similarity:66/130 - (50%) Gaps:26/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN-KAP-----GAVEAFKALGNAAGVLTDAEKRK 164
            |:|:||||::.||..|:|.|:::||::.||||: ::|     .|...||.:..|..||.|..||.
plant     3 DHYQVLGVTRNATKKEVKDAFRRLAIKYHPDKHAQSPEHVRHNATVRFKLVSEAYEVLNDDLKRA 67

  Fly   165 NYDLYGINES--------HNGHGNNGGGHHGHGQYYNNEYGYS-RGFQADISAEELFNMFFNGGF 220
            :|:....::.        .|.:||.||...|.|  |...|||| |..||.         .|:.||
plant    68 SYNAGSDSDCFRRTSGSYSNPYGNRGGRAQGSG--YGYGYGYSTRNRQAS---------SFSSGF 121

  Fly   221  220
            plant   122  121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 44/128 (34%)
DUF1977 264..364 CDD:462754
AT2G41000NP_001118491.1 DnaJ 3..70 CDD:395170 27/66 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.