DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb1

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_061278.1 Gene:Dnajb1 / 81489 MGIID:1931874 Length:340 Species:Mus musculus


Alignment Length:210 Identity:65/210 - (30%)
Similarity:95/210 - (45%) Gaps:26/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||:.||:::.|:|.|||:||::.||:.||||||.|||.|.||.:..|..||:|..||:.:|.|
Mouse     3 KDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRY 67

  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQRRRQ 234
            | .|...|...:||...|     .|...:|..|..|..|  :|..||.|..|......:      
Mouse    68 G-EEGLKGGSPSGGSSGG-----ANGTSFSYTFHGDPHA--MFAEFFGGRNPFDTFFGQ------ 118

  Fly   235 QAREDREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPSHKYSVKRETNSLKVPYYVKDN 299
              |...||.:.....:..|    :|:...::........|..|:.|......|:.|:|      :
Mouse   119 --RNGEEGMDIDDTFSSFP----MGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLRV------S 171

  Fly   300 FYSEYQGSVARLEES 314
            ....|.|...:::.|
Mouse   172 LEEIYSGCTKKMKIS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 51/118 (43%)
DnaJ 106..167 CDD:278647 32/60 (53%)
DUF1977 269..366 CDD:286411 9/46 (20%)
Dnajb1NP_061278.1 DnaJ 1..340 CDD:223560 65/210 (31%)
DnaJ 4..65 CDD:278647 32/60 (53%)
DnaJ_C 162..326 CDD:199909 6/31 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844302
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.