powered by:
Protein Alignment CG3061 and DNAJC22
DIOPT Version :9
Sequence 1: | NP_650328.1 |
Gene: | CG3061 / 41707 |
FlyBaseID: | FBgn0038195 |
Length: | 370 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001291873.1 |
Gene: | DNAJC22 / 79962 |
HGNCID: | 25802 |
Length: | 341 |
Species: | Homo sapiens |
Alignment Length: | 57 |
Identity: | 21/57 - (36%) |
Similarity: | 32/57 - (56%) |
Gaps: | 2/57 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEK 162
|:|||:|:.||:.||.::|::|....|||.| :...|...|..:..|..||:...|
Human 279 YQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRK 335
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3061 | NP_650328.1 |
DnaJ |
105..>224 |
CDD:223560 |
21/57 (37%) |
DnaJ |
106..167 |
CDD:278647 |
21/57 (37%) |
DUF1977 |
269..366 |
CDD:286411 |
|
DNAJC22 | NP_001291873.1 |
DnaJ |
278..335 |
CDD:197617 |
20/55 (36%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.