DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3061 and Dnajc21

DIOPT Version :9

Sequence 1:	NP_650328.1	Gene:	CG3061 / 41707	FlyBaseID:	FBgn0038195	Length:	370	Species:	Drosophila melanogaster
Sequence 2:	NP_084322.2	Gene:	Dnajc21 / 78244	MGIID:	1925371	Length:	531	Species:	Mus musculus

Alignment Length:	131	Identity:	48/131 - (36%)
Similarity:	64/131 - (48%)	Gaps:	33/131 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYD 167
            |.:||.|||.:.|::.|:||||:||||:.|||||  .|..|.|.||.:..|..||:|.::|..||
Mouse     2 KCHYEALGVRRDASEEELKKAYRKLALRWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYD 66

  Fly   168 LYGINESHNGHGNNGGGHHGHGQYYNNEY------------GY---SRGFQAD-------ISAEE 210
                  :|......||   ..|:|.::..            ||   .|||.|.       |:.||
Mouse    67 ------NHREALLKGG---LDGEYQDDSLDLLHYFTVTCYSGYGDDERGFYAVYRVVFELIAKEE 122

  Fly   211 L 211
            |
Mouse   123 L 123

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3061	NP_650328.1	DnaJ	105..>224	CDD:223560	48/131 (37%)
		DnaJ	106..167	CDD:278647	30/62 (48%)
		DUF1977	269..366	CDD:286411
Dnajc21	NP_084322.2	DnaJ	3..66	CDD:278647	30/62 (48%)
		DBINO	<181..243	CDD:290603
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	278..309
		zf-C2H2_jaz	314..339	CDD:288983
		C2H2 Zn finger	316..338	CDD:275371
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	327..480
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	507..531
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0714
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900