powered by:
Protein Alignment CG3061 and Dnajc22
DIOPT Version :9
Sequence 1: | NP_650328.1 |
Gene: | CG3061 / 41707 |
FlyBaseID: | FBgn0038195 |
Length: | 370 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_789805.1 |
Gene: | Dnajc22 / 72778 |
MGIID: | 1920028 |
Length: | 339 |
Species: | Mus musculus |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 31/57 - (54%) |
Gaps: | 2/57 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKNK--APGAVEAFKALGNAAGVLTDAEK 162
::||||.:.||:.||.::|:.|....|||.|: ...|...|..:..|..||:..:|
Mouse 279 HQVLGVPEGATNEEIHRSYRDLVKVWHPDHNRHQTEEAQRHFLEIQAAYEVLSQPKK 335
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.