DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajc25

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001028337.2 Gene:Dnajc25 / 72429 MGIID:1919679 Length:357 Species:Mus musculus


Alignment Length:321 Identity:63/321 - (19%)
Similarity:118/321 - (36%) Gaps:125/321 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNK---------APGAVEAFKALGNAAGVLTDA 160
            :|.|||||||::|:.:||.:||::||.:.|||:.:         ||.:.|||..:..|...|.|.
Mouse    47 RDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDE 111

  Fly   161 EKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNV 225
            |.||:|| |.::...              :||::.|.|                           
Mouse   112 ETRKDYD-YMLDHPE--------------EYYSHYYHY--------------------------- 134

  Fly   226 HMRQQRRRQQAREDREGNNSSALVNLLPIVLLIGLSMMS------------SFFISDPMYSLTPS 278
                ..||...:.|         |.::.:|.:..:||..            |:..:.|.|.:..:
Mouse   135 ----YSRRLAPKVD---------VRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQAT 186

  Fly   279 HKYSVKRETNSLKVPYYVKDNFYSEYQGSVARLEESVEEDFVNHLKHSCS---------RERNYR 334
               .:.:|...||         .::.:|...:.:|.:.::..|.:|:...         ::...|
Mouse   187 ---EIAKEQGLLK---------KAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVR 239

  Fly   335 DSML-------------------------AKARTFGDRD-LY--RKAQNINTPSCENLQKY 367
            |.:|                         .|.:.:|:.: ||  ||:..::....::|:.:
Mouse   240 DLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 36/127 (28%)
DnaJ 106..167 CDD:278647 29/69 (42%)
DUF1977 269..366 CDD:286411 19/133 (14%)
Dnajc25NP_001028337.2 DnaJ 48..118 CDD:365959 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.