DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb13

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_705755.2 Gene:Dnajb13 / 69387 MGIID:1916637 Length:316 Species:Mus musculus


Alignment Length:201 Identity:60/201 - (29%)
Similarity:86/201 - (42%) Gaps:52/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYG 170
            |||.||.|::.:.|::|||||:||||:.||.|:..|||.|.||.:..|..||:|..||..||.:|
Mouse     4 DYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKSSEPGAPEIFKQIAEAYDVLSDPVKRGIYDKFG 68

  Fly   171 INESHNGHGNNGGGHHGHGQYYNNEYG----YSRGFQADISAEELFNMFFNGGFPQQNVHMRQQR 231
                  ..|..||        ...|:|    ::.|:....:.:::|:.||.|..|.....     
Mouse    69 ------EEGLKGG--------IPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFF----- 114

  Fly   232 RRQQAREDREGNNSSALVNLL----------PIVLLIGLSMMSSFF------------ISDPMYS 274
                   |.|||:.......|          ||...:.||:...||            :::..||
Mouse   115 -------DAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYS 172

  Fly   275 LTPSHK 280
            .|...|
Mouse   173 STIKDK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 45/121 (37%)
DnaJ 106..167 CDD:278647 31/60 (52%)
DUF1977 269..366 CDD:286411 4/12 (33%)
Dnajb13NP_705755.2 DnaJ 1..312 CDD:223560 60/201 (30%)
DnaJ 4..65 CDD:278647 31/60 (52%)
DnaJ_C 138..302 CDD:199909 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.