Sequence 1: | NP_650328.1 | Gene: | CG3061 / 41707 | FlyBaseID: | FBgn0038195 | Length: | 370 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_705755.2 | Gene: | Dnajb13 / 69387 | MGIID: | 1916637 | Length: | 316 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 60/201 - (29%) |
---|---|---|---|
Similarity: | 86/201 - (42%) | Gaps: | 52/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYG 170
Fly 171 INESHNGHGNNGGGHHGHGQYYNNEYG----YSRGFQADISAEELFNMFFNGGFPQQNVHMRQQR 231
Fly 232 RRQQAREDREGNNSSALVNLL----------PIVLLIGLSMMSSFF------------ISDPMYS 274
Fly 275 LTPSHK 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3061 | NP_650328.1 | DnaJ | 105..>224 | CDD:223560 | 45/121 (37%) |
DnaJ | 106..167 | CDD:278647 | 31/60 (52%) | ||
DUF1977 | 269..366 | CDD:286411 | 4/12 (33%) | ||
Dnajb13 | NP_705755.2 | DnaJ | 1..312 | CDD:223560 | 60/201 (30%) |
DnaJ | 4..65 | CDD:278647 | 31/60 (52%) | ||
DnaJ_C | 138..302 | CDD:199909 | 10/41 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |