DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb2

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:278 Identity:72/278 - (25%)
Similarity:104/278 - (37%) Gaps:83/278 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            |||:|.|.::|:..:|||||:|.|||.|||||  ....|.:.||.:..|..||:|..||:.||.|
  Rat     4 YYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68

  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFP------------- 221
            | .|...|.|:........|.    |.|::..|:   |.||:|..||..|.|             
  Rat    69 G-REGLTGAGSGPSRSETGGM----EPGFTFTFR---SPEEVFREFFGSGDPFSELFDDLGAFSE 125

  Fly   222 QQNVHMR------------------------------------------QQRR----------RQ 234
            .||...|                                          |.||          ::
  Rat   126 LQNQGSRLTGPFFTFSSSFPGNSDFSSSSFSFSPGAGAFRSVSTSTTFVQGRRITTRRIMENGQE 190

  Fly   235 QAREDREGNNSSALVNLLPIVLLIGLSMMSSFFISDPMYSLTPSHKYSVKRETNSLKVPYYVKDN 299
            :...:.:|...|..:|.:|..|.:||.:..    .:...|:||.......|.|:..:.|    |:
  Rat   191 RVEVEEDGQLKSVSINGVPDDLALGLELSR----REQQPSVTPGLGVMQVRPTSVSRPP----DS 247

  Fly   300 FYSEYQGSVARLEESVEE 317
            ..||.:.....:..|:.|
  Rat   248 DLSEDEDMQLAMAYSLSE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 48/131 (37%)
DnaJ 106..167 CDD:278647 29/61 (48%)
DUF1977 269..366 CDD:286411 11/49 (22%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 46/113 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347681
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.