DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and zgc:122979

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 / 641576 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio


Alignment Length:177 Identity:58/177 - (32%)
Similarity:81/177 - (45%) Gaps:29/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NGKSRTAGASDEKDSGPRKRVNSDSRSSAPDYTKDQLEAVRKVKTCKDYYEVLGVSKTATDSEIK 123
            |.|.:......|:.|...:.|..:...|:|..:.:          |.|||.|||||..:.:.||:
Zfish    14 NVKCKVRVIHGEEGSWSSEEVREEPEVSSPPPSPE----------CVDYYSVLGVSNDSNEEEIR 68

  Fly   124 KAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGI---------NESHNGHG 179
            ||||:|||:.|||||....|.:.||.:..|..||||.|||..||..|:         |::...|.
Zfish    69 KAYKRLALRYHPDKNSDADAEDKFKQIAQAYDVLTDPEKRNIYDQQGLTKGGVAPTCNKTDPSHN 133

  Fly   180 NNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVH 226
            :....|..| .::|        |..| |.::|||.|.....|..:.|
Zfish   134 SKADAHSWH-MFFN--------FDLD-SDDDLFNPFTRNPLPHLSRH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 49/127 (39%)
DnaJ 106..167 CDD:278647 33/60 (55%)
DUF1977 269..366 CDD:286411
zgc:122979NP_001032663.2 DnaJ 50..355 CDD:223560 50/131 (38%)
DnaJ 51..112 CDD:278647 33/60 (55%)
DnaJ_C 185..345 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.