DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnajb9a

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001020355.1 Gene:dnajb9a / 574005 ZFINID:ZDB-GENE-050626-115 Length:218 Species:Danio rerio


Alignment Length:145 Identity:52/145 - (35%)
Similarity:79/145 - (54%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||::|||.|.|::.:||||:.|||::.||||||:|.|...|:.:..|...|:|.::|:.||..
Zfish    25 KDYYDILGVPKDASERQIKKAFHKLAMKYHPDKNKSPDAENKFREIAEAYETLSDEKRRREYDRL 89

  Fly   170 GINESHNGHGN---NGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQR 231
            |    |:...|   ||||  |.||.:::.:        |.:.:::|..|   ....||.|.|.:|
Zfish    90 G----HSAFTNDDTNGGG--GAGQRFHHSF--------DFNFDDMFRDF---DIYSQNRHARPKR 137

  Fly   232 ------RRQQAREDR 240
                  |..|.:.:|
Zfish   138 HFEEHFRAHQQQHNR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 44/121 (36%)
DnaJ 106..167 CDD:278647 28/60 (47%)
DUF1977 269..366 CDD:286411
dnajb9aNP_001020355.1 DnaJ 26..87 CDD:278647 28/60 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.