DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb2

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_036008391.1 Gene:Dnajb2 / 56812 MGIID:1928739 Length:365 Species:Mus musculus


Alignment Length:88 Identity:28/88 - (31%)
Similarity:36/88 - (40%) Gaps:13/88 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DKNKAP-GAVEAFKALGNAAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYS 199
            |...:| ||:...|. |....:|.: .||:.||.|| .|...|.|:        |...:...|..
Mouse    77 DTRPSPRGAITFLKG-GMTRSLLLE-HKREIYDRYG-REGLTGAGS--------GPSRSETGGAG 130

  Fly   200 RGFQADI-SAEELFNMFFNGGFP 221
            .||.... |.||:|..||..|.|
Mouse   131 PGFTFTFRSPEEVFREFFGSGDP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 28/88 (32%)
DnaJ 106..167 CDD:278647 9/31 (29%)
DUF1977 269..366 CDD:286411
Dnajb2XP_036008391.1 PRK14294 102..>151 CDD:237664 19/57 (33%)
UIM 291..310 CDD:197845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844317
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.