DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Dnajb8

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001102718.1 Gene:Dnajb8 / 500253 RGDID:1561981 Length:230 Species:Rattus norvegicus


Alignment Length:115 Identity:44/115 - (38%)
Similarity:61/115 - (53%) Gaps:13/115 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYDL 168
            :|||||||..:|:..:|||||:||||:.|||||  ....|.:.||.:..|..||:|::||..||.
  Rat     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDR 67

  Fly   169 YGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNG 218
            .|.    :|....||....|...:...|.:.       :.|::|..||.|
  Rat    68 AGC----DGWRAGGGASVPHAGPFGAGYPFR-------NPEDIFREFFGG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 44/115 (38%)
DUF1977 264..364 CDD:462754
Dnajb8NP_001102718.1 PRK10767 1..>131 CDD:236757 44/115 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.