DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnaja2

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001004807.1 Gene:dnaja2 / 448048 XenbaseID:XB-GENE-998337 Length:410 Species:Xenopus tropicalis


Alignment Length:121 Identity:46/121 - (38%)
Similarity:67/121 - (55%) Gaps:17/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY--- 169
            |::|||:..|:::::||||:|||.:.|||||  |.|.:.||.:..|..||::.|||:.||.|   
 Frog    10 YDILGVAPGASENDLKKAYRKLAKEYHPDKN--PNAGDKFKEISFAYEVLSNPEKRELYDRYGEQ 72

  Fly   170 GINESHNGHGNN-------GGGHHGH-GQYYNNEYGYSRG----FQADISAEELFN 213
            |:.|...|.|.:       |||..|. |....:..|..||    ....:|.|:|:|
 Frog    73 GLREGSGGSGMDDIFSHIFGGGLFGFMGGQSRSRNGRRRGEDMMHPLKVSLEDLYN 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 46/121 (38%)
DUF1977 264..364 CDD:462754
dnaja2NP_001004807.1 PTZ00037 4..410 CDD:240236 46/121 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.