DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnajb1a

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001003571.1 Gene:dnajb1a / 445177 ZFINID:ZDB-GENE-040801-90 Length:335 Species:Danio rerio


Alignment Length:137 Identity:54/137 - (39%)
Similarity:73/137 - (53%) Gaps:20/137 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169
            ||||.:||:.|.|:|.||||||:|.||:.||||||:.||.:.||.:..|..||:||:|:..||.|
Zfish     3 KDYYRILGIEKGASDEEIKKAYRKQALRFHPDKNKSAGAEDKFKEIAEAYDVLSDAKKKDIYDRY 67

  Fly   170 GIN--ESHNGHGNNGGGHHGHG-----------------QYYNNEYGYSRGFQADISAEELFNMF 215
            |.:  :.|.|.|.||..:..||                 .::.:..|.:.|...| .....|.|.
Zfish    68 GEDGLKGHAGSGTNGPSYTFHGDPHAMFAEFFGGRSPFDHFFASAGGPNDGMDID-DPFGAFGMG 131

  Fly   216 FNGGFPQ 222
            ..||||:
Zfish   132 GMGGFPR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 54/137 (39%)
DnaJ 106..167 CDD:278647 33/60 (55%)
DUF1977 269..366 CDD:286411
dnajb1aNP_001003571.1 DnaJ 1..335 CDD:223560 54/137 (39%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 157..321 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.