DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and dnajb6a

DIOPT Version :10

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001002353.1 Gene:dnajb6a / 436626 ZFINID:ZDB-GENE-040718-45 Length:316 Species:Danio rerio


Alignment Length:153 Identity:57/153 - (37%)
Similarity:72/153 - (47%) Gaps:35/153 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 DYYEVLGVSKTATDSEIKKAYKKLALQLHPDKN--KAPGAVEAFKALGNAAGVLTDAEKRKNYDL 168
            |||:||||.|||:..:|||||:||||:.|||||  ....|.:.||.|..|..||:||.||..||.
Zfish     3 DYYQVLGVQKTASPDDIKKAYRKLALRWHPDKNPDNKEDAEKKFKELSEAYEVLSDANKRSLYDR 67

  Fly   169 YGINESHNGHGNNGGGHH--GHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFP---------- 221
            || .|.....|..|..||  |.|..:.|             .|::|..||.|..|          
Zfish    68 YG-KEGLTPGGGGGREHHFGGGGFTFRN-------------PEDVFREFFGGQDPFADFFGADPF 118

  Fly   222 -------QQNVHMRQQRRRQQAR 237
                   :::.|...||...::|
Zfish   119 GDDFFGGRRHYHHHHQRGMSRSR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 52/117 (44%)
DUF1977 264..364 CDD:462754
dnajb6aNP_001002353.1 PRK10767 1..>122 CDD:236757 53/132 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.