DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3061 and Droj2

DIOPT Version :9

Sequence 1:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650283.1 Gene:Droj2 / 41646 FlyBaseID:FBgn0038145 Length:403 Species:Drosophila melanogaster


Alignment Length:126 Identity:48/126 - (38%)
Similarity:61/126 - (48%) Gaps:23/126 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 YYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLYGI 171
            ||::|||...||..|:||||:||||:.|||||  |...|.|||:..|..||:||:||:.||    
  Fly     7 YYDILGVKPNATPDELKKAYRKLALKYHPDKN--PNEGEKFKAISQAYEVLSDADKRQVYD---- 65

  Fly   172 NESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQRR 232
             |........||...|.   :.|..             :.|..||..||.......|::||
  Fly    66 -EGGEAAIKKGGADSGD---FRNPM-------------DFFEKFFGAGFGGSGGGRRRERR 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 45/116 (39%)
DnaJ 106..167 CDD:278647 33/59 (56%)
DUF1977 269..366 CDD:286411
Droj2NP_650283.1 PTZ00037 2..398 CDD:240236 48/126 (38%)
DnaJ 7..65 CDD:278647 33/59 (56%)
DnaJ_C 112..336 CDD:199909
DnaJ_zf 140..206 CDD:199908
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.